show cdp neighbors on meraki

{ { }, { It will display the directly connected neighbors, namely RouterA and RouterB, and you can see the host names, local interfaces where you are seeing that device, and their own interface where they are seeing you. "showCountOnly" : "false", LITHIUM.AjaxSupport.fromLink('#kudoEntity_4', 'kudoEntity', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {}, 'kklYZlNiT6SnwZr1I5N-sWYpatlIXSzAXARzkaLaR8w. ] }, Right-click the vDS and click Edit Settings. "action" : "rerender" "useSimpleView" : "false", { then under 'API access' generate new API key). } ] "context" : "envParam:quiltName,message", "event" : "editProductMessage", { "actions" : [ { "actions" : [ "linkDisabled" : "false" { } }, "event" : "expandMessage", $search.find('input.search-input').keyup(function(e) { "includeRepliesModerationState" : "true", "actions" : [ "event" : "ProductAnswer", ] } CDP is a Cisco proprietary protocol and will only detect Cisco products, although there are some vendors that do work with it. "action" : "rerender" "event" : "MessagesWidgetEditCommentForm", If you are using Cisco switches in . ] "action" : "rerender" "parameters" : { "actions" : [ "initiatorDataMatcher" : "data-lia-kudos-id" The domain name that you get in show cdp nei detail" command is VTP domain name of the adjacent switch. "context" : "", "disableKudosForAnonUser" : "false", } "displayStyle" : "horizontal", }, "actions" : [ "revokeMode" : "true", }, ] "linkDisabled" : "false" { "componentId" : "forums.widget.message-view", "action" : "rerender" { "disableLinks" : "false", "event" : "removeMessageUserEmailSubscription", "context" : "envParam:quiltName,message,product,contextId,contextUrl", { NAS storage management. { } var $search = $('.cmp-header__search-container'); "event" : "MessagesWidgetCommentForm", } ', 'ajax');","content":"Turn off suggestions"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_10f452b179b055d_0","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.messagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/security/message-id/7046/thread-id/7046&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); { "event" : "MessagesWidgetCommentForm", "context" : "envParam:selectedMessage", }, "context" : "", Are you sure you want to proceed? ', 'ajax'); { { "action" : "rerender" { "action" : "pulsate" "displaySubject" : "true" "displaySubject" : "true" ] ] ","messageActionsSelector":"#messageActions_5","loaderSelector":"#loader","renderEvent":"LITHIUM:renderInlineMessageReply","expandedRepliesSelector":".lia-inline-message-reply-form-expanded","topicMessageSelector":".lia-forum-topic-message-gte-5","containerSelector":"#inlineMessageReplyContainer_5","layoutView":"threaded","replyButtonSelector":".lia-action-reply","messageActionsClass":"lia-message-actions","threadedMessageViewSelector":".lia-threaded-display-message-view-wrapper","lazyLoadScriptsEvent":"LITHIUM:lazyLoadScripts","isGteForumV5":true,"loaderEnabled":false,"useSimpleEditor":false,"isReplyButtonDisabled":false}); "event" : "expandMessage", "disableLabelLinks" : "false", { "event" : "MessagesWidgetEditAction", { { The feature is still missing on the dashboard. "actions" : [ "action" : "addClassName" "context" : "envParam:quiltName,expandedQuiltName", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, } { "includeRepliesModerationState" : "true", { . { ] ] { "action" : "rerender" The priority was on providing the controls which would enable Meraki-to-Meraki . { }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lazyLoadScripts"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer_1","action":"lazyLoadScripts","feedbackSelector":"#inlineMessageReplyContainer_1","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:lazyloadscripts?t:ac=board-id/security/message-id/7046/thread-id/7046&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"pWw0YiVwPnc_V-1bt4vv27cWkhfeNGpyu7pEPLTyL18. ] "parameters" : { "actions" : [ }, { "parameters" : { "useCountToKudo" : "false", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { }, "context" : "", ] "event" : "removeThreadUserEmailSubscription", "useSimpleView" : "false", "context" : "envParam:quiltName", { "}); "actions" : [ "event" : "editProductMessage", "action" : "rerender" { "action" : "pulsate" { "event" : "addMessageUserEmailSubscription", "context" : "envParam:quiltName", } { { The Meraki MS390 is the most powerful access switch in the Meraki portfolio which combines the simplicity of cloud-managed IT with the power of innovative Cisco switching technology. "truncateBodyRetainsHtml" : "false", "actions" : [ } { Use information provided by Cisco Discovery Protocol (CDP) to verify proper device interconnection. "componentId" : "kudos.widget.button", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.AjaxSupport.fromLink('#kudoEntity', 'kudoEntity', '#ajaxfeedback', 'LITHIUM:ajaxError', {}, 'uw2lWvnbyhhD213JoyiL7RHgUFEJq1spidC1VniTr9Y. "forceSearchRequestParameterForBlurbBuilder" : "false", { } "action" : "rerender" "actions" : [ ] LITHIUM.AutoComplete({"options":{"triggerTextLength":4,"updateInputOnSelect":true,"loadingText":"Searching","emptyText":"No Matches","successText":"Results:","defaultText":"Enter a search word","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Turn off suggestions"}],"prefixTriggerTextLength":0},"inputSelector":"#noteSearchField_10f452b179b055d_0","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.notesearchfield.notesearchfield:autocomplete?t:ac=board-id/security/message-id/7046/thread-id/7046&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); { "truncateBody" : "true", "disableLabelLinks" : "false", "displaySubject" : "true" { }, I guess I should have tried. LITHIUM.AutoComplete({"options":{"triggerTextLength":4,"updateInputOnSelect":true,"loadingText":"Searching","emptyText":"No Matches","successText":"Results:","defaultText":"Enter a search word","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_10f452b197e30fd', 'disableAutoComplete', '#ajaxfeedback_10f452b179b055d_0', 'LITHIUM:ajaxError', {}, 'pJTqxKfOOYeElVWWxfbwf2UM6EJOZ6Kr7OzvcFxKtao. This command shows detailed information about the Cisco devices that are directly connected to your current device, including IP addresses. So things like CDP are not available. { }, "actions" : [ { "actions" : [ "actions" : [ LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; "selector" : "#messageview_1", { "useTruncatedSubject" : "true", "actions" : [ "}); { ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_0","feedbackSelector":".InfoMessage"}); "event" : "approveMessage", Port status as seen in the default dashboard color mode. "actions" : [ { Are you sure you want to proceed? "action" : "rerender" }, "initiatorDataMatcher" : "data-lia-message-uid" LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"threadeddetaildisplaymessageviewwrapper_0","componentSelector":"#threadeddetaildisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":29618,"confimationText":"You have other message editors open and your data inside of them might be lost. "action" : "pulsate" } } } "selector" : "#messageview_0", } ] } This section lists the top 10 Cisco Meraki devices in the network, ranked by total network usage, along with the total number of unique clients that used the device. } I wrote a Python script that uses Meraki API to list LLDP and CDP information for a device. { }, "linkDisabled" : "false" }, \\n\\t\\t\\t\\n\\t\\n\\n\\t\\n\\n\\t\\t\";LITHIUM.AjaxSupport.defaultAjaxErrorHtml = \", \\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\t\\t\\t\\t\\t, Cloud Monitoring for Catalyst - Early Availability Group, https://github.com/routetonull/getMerakiNeighbor. LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Searching for users","emptyText":"No Matches","successText":"Users found:","defaultText":"Enter a user name or rank","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Turn off suggestions"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_10f452b179b055d","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/security/message-id/7046/thread-id/7046&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); Network management. ], } "action" : "rerender" "event" : "addMessageUserEmailSubscription", "}); { { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lazyLoadScripts"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer_5","action":"lazyLoadScripts","feedbackSelector":"#inlineMessageReplyContainer_5","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:lazyloadscripts?t:ac=board-id/security/message-id/7046/thread-id/7046&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"gzVq_1RKEaSIC0eSeagZ9_hj14P3pIknp5aHlMBErhI. "action" : "rerender" ] "action" : "rerender" // console.log('Header search input', e.keyCode); { "action" : "rerender" "action" : "rerender" ] }); "action" : "rerender" "showCountOnly" : "false", { }, "revokeMode" : "true", "event" : "MessagesWidgetEditCommentForm", ] "disableLabelLinks" : "false", } the catalyst switch shows mac addresses of the neighboring switches in Sh cdp neighbors. ] { "event" : "AcceptSolutionAction", } { { "context" : "", "context" : "", "}); Your script really steps it up. }, { "actions" : [ } "useSubjectIcons" : "true", } "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "eventActions" : [ } }, LITHIUM.SearchForm({"asSearchActionIdSelector":".lia-as-search-action-id","useAutoComplete":true,"selectSelector":".lia-search-form-granularity","useClearSearchButton":false,"buttonSelector":".lia-button-searchForm-action","asSearchActionIdParamName":"as-search-action-id","formSelector":"#lia-searchformV32_10f452b179b055d","nodesModel":{"tkb|tkb":{"title":"Knowledge base","inputSelector":".lia-search-input-tkb-article"},"security|forum-board":{"title":"Search Board: Security / SD-WAN","inputSelector":".lia-search-input-message"},"meraki|category":{"title":"Search Community: Security / SD-WAN","inputSelector":".lia-search-input-message"},"enterprise|category":{"title":"Search Category: Security / SD-WAN","inputSelector":".lia-search-input-message"},"user|user":{"title":"User Search","inputSelector":".lia-search-input-user"}},"asSearchActionIdHeaderKey":"X-LI-AS-Search-Action-Id","inputSelector":"#messageSearchField_10f452b179b055d_0:not(.lia-js-hidden)","clearSearchButtonSelector":null}); "action" : "rerender" LLDP vs CDP - Cisco Learning Network 15 lines) of information, one set for every neighbor - show cdp entry "name" = lists the same information . Dragging the columns to re-order them; Adding/removing columns using the button; Export the neighbor table by Clicking the button to copy tab-seperated data (ready to paste into a spreadsheet) to your clipboard . "message" : "99480", "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:sortLabelsWidget","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#labelsTaplet","action":"sortLabelsWidget","feedbackSelector":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.labelstaplet:sortlabelswidget?t:ac=board-id/security/message-id/7046/thread-id/7046&t:cp=labels/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"BivIcsFIXzjEAAmRgP8R9qPwPsiiF-9V0C1UfYOXnlc. "context" : "", } "event" : "ProductAnswerComment", "actions" : [ } "actions" : [ Output will look similar to this (Output is from a 9800CL) I didn't realize how clean the 9800 AP CDP command would look like. "context" : "", }); "useSimpleView" : "false", "context" : "", "context" : "envParam:quiltName,product,contextId,contextUrl", { ], ] "action" : "rerender" "disableKudosForAnonUser" : "false", LITHIUM.InlineMessageReplyContainer({"openEditsSelector":".lia-inline-message-edit","linearDisplayViewSelector":".lia-linear-display-message-view","renderEventParams":{"replyWrapperId":"replyWrapper","messageId":29378,"messageActionsId":"messageActions"},"threadedDetailDisplayViewSelector":".lia-threaded-detail-display-message-view","isRootMessage":true,"replyEditorPlaceholderWrapperSelector":".lia-placeholder-wrapper","collapseEvent":"LITHIUM:collapseInlineMessageEditor","confimationText":"You have other message editors open and your data inside of them might be lost. }); ] }); } { { { LITHIUM.Link({"linkSelector":"a.lia-link-ticket-post-action"}); LITHIUM.AutoComplete({"options":{"triggerTextLength":4,"updateInputOnSelect":true,"loadingText":"Searching","emptyText":"No Matches","successText":"Results:","defaultText":"Enter a search word","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_10f452b19a7df72', 'disableAutoComplete', '#ajaxfeedback_10f452b179b055d_0', 'LITHIUM:ajaxError', {}, '6FoqepZx2dFYXAX4A9dTEhOZqVpwTgFMdXC9n2FGsOU. "context" : "", "actions" : [ "action" : "pulsate" "actions" : [ My goal was to provide the script to a NOC to allow the operators to get the information from a simple to use CLI command. "actions" : [ "action" : "rerender" { "event" : "editProductMessage", "useCountToKudo" : "false", "actions" : [ ] "action" : "rerender" "event" : "ProductAnswer", "includeRepliesModerationState" : "true", "context" : "envParam:quiltName,message", { ', 'ajax'); "event" : "MessagesWidgetMessageEdit", "actions" : [ } "actions" : [ ] "action" : "rerender" "event" : "editProductMessage", }, "useSortHeader" : "false", } "event" : "unapproveMessage", "useSimpleView" : "false", "entity" : "29618", { "event" : "addMessageUserEmailSubscription", "disableLinks" : "false", "actions" : [ "action" : "rerender" "action" : "rerender" "actions" : [ { "context" : "", "context" : "", ] { { Is there a way to view LLDP or CDP neighbours on an MX device? ] }, LITHIUM.InlineMessageReplyContainer({"openEditsSelector":".lia-inline-message-edit","linearDisplayViewSelector":".lia-linear-display-message-view","renderEventParams":{"replyWrapperId":"replyWrapper_2","messageId":29619,"messageActionsId":"messageActions_2"},"threadedDetailDisplayViewSelector":".lia-threaded-detail-display-message-view","isRootMessage":false,"replyEditorPlaceholderWrapperSelector":".lia-placeholder-wrapper","collapseEvent":"LITHIUM:collapseInlineMessageEditor","confimationText":"You have other message editors open and your data inside of them might be lost. "kudosLinksDisabled" : "false", "context" : "envParam:quiltName,message,product,contextId,contextUrl", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "action" : "rerender" "action" : "rerender" "actions" : [ "actions" : [ "event" : "MessagesWidgetCommentForm", "context" : "envParam:quiltName,message", "action" : "rerender" } "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "context" : "", ","topicMessageSelector":".lia-forum-topic-message-gte-5","focusEditor":false,"hidePlaceholderShowFormEvent":"LITHIUM:hidePlaceholderShowForm","formWrapperSelector":"#inlinemessagereplyeditor_0 .lia-form-wrapper","reRenderInlineEditorEvent":"LITHIUM:reRenderInlineEditor","ajaxBeforeSendEvent":"LITHIUM:ajaxBeforeSend:InlineMessageReply","element":"input","clientIdSelector":"#inlinemessagereplyeditor_0","loadAutosaveAction":false,"newPostPlaceholderSelector":".lia-new-post-placeholder","placeholderWrapperSelector":"#inlinemessagereplyeditor_0 .lia-placeholder-wrapper","messageId":29378,"formSelector":"#inlinemessagereplyeditor_0","expandedClass":"lia-inline-message-reply-form-expanded","expandedRepliesSelector":".lia-inline-message-reply-form-expanded","newPostPlaceholderClass":"lia-new-post-placeholder","editorLoadedEvent":"LITHIUM:editorLoaded","replyEditorPlaceholderWrapperCssClass":"lia-placeholder-wrapper","messageActionsClass":"lia-message-actions","cancelButtonSelector":"#inlinemessagereplyeditor_0 .lia-button-Cancel-action","isGteForumV5":true,"messageViewWrapperSelector":".lia-threaded-detail-display-message-view","disabledReplyClass":"lia-inline-message-reply-disabled-reply"}); "context" : "lia-deleted-state", LITHIUM.AjaxSupport.ComponentEvents.set({ }, } "actions" : [ { }, { "context" : "", "context" : "", }, ] "revokeMode" : "true", ] "action" : "rerender" "kudosable" : "true", } "context" : "", LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" "context" : "envParam:quiltName", "actions" : [ "event" : "ProductAnswerComment", Using the example above, the AP is directly communicating with four mesh neighbors: Outdoor, Indoor, MR14, and MR58. "revokeMode" : "true", LITHIUM.Placeholder(); { { }, } I built my own tool, code is public and open source: https://github.com/routetonull/getMerakiNeighbor, \\n\\t\\t\\t\\t\\t\\tSorry, unable to complete the action you requested.\\n\\t\\t\\t\\t\\t\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\t\\t\\t\\n\\n\\t\\t\\t\\n\\t\\t\";LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_10f452b17e2d061', 'disableAutoComplete', '#ajaxfeedback_10f452b179b055d_0', 'LITHIUM:ajaxError', {}, 'rM1T64jM7TC6jQmjCPhJQkZe3cg2gPThot-jtPAGQJg. { ] { }); ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_10f452b179b055d","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_10f452b179b055d_0","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.usersearchfield:userexistsquery?t:ac=board-id/security/message-id/7046/thread-id/7046&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"G26YlnjMXlZ6vpSLPTgWV10jRwHzPCo8A6L6KQWRvkg. "disallowZeroCount" : "false", }, if ( e.keyCode === 13 ) { { } }, ] The Switch Ports section shows a basic view of the status of all switch ports. }, }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_5","feedbackSelector":".InfoMessage"}); ] Are you sure you want to proceed? "event" : "removeMessageUserEmailSubscription", // -->, View LLDP or CDP information on MX device. } "actions" : [ }, { Make sure the switch supports PoE. "event" : "sortLabelsWidget", }, Supporting device can receive this frame and update their CDP tables. "event" : "AcceptSolutionAction", /meraki get-lldp-cdp [org-name] [device-name]: Query Meraki for List of LLDP or CDP Neighbors. ] "disableKudosForAnonUser" : "false", "actions" : [ Are you sure you want to proceed? PS: I found this script on github. ] "action" : "rerender" ], CDP sends CDP packets every 60 seconds by default. "event" : "MessagesWidgetEditCommentForm", "context" : "envParam:selectedMessage", ] } "event" : "unapproveMessage", "event" : "expandMessage", { "event" : "kudoEntity", "action" : "rerender" "event" : "MessagesWidgetEditCommentForm", }, "event" : "ProductAnswer", "action" : "pulsate" }, "action" : "pulsate" For whatever reason, Meraki has never seen it as important to give full lldp information for devices connected to an MX: This is utterly nonsensical for enterprise-grade networking equipment. The show cdp neighbors detail is another similar command we can use to gather more detailed information about directly connected devices. Use the interface configuration command no cdp enable to disable CDP on a specific interface: RouterOrSwitch (config)#interface fastethernet 0/1. "event" : "ProductMessageEdit", ] { }, "actions" : [ We could use the command "show cdp neighbor" to find if this port is connected to another switch. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_23","feedbackSelector":".InfoMessage"}); { "context" : "envParam:quiltName,message", ] "parameters" : { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_7","feedbackSelector":".InfoMessage"}); "actions" : [ Simply navigate in the Cisco Meraki dashboard to the switch port connected to the IP phone, and specify the desired voice VLAN. "actions" : [ { . "action" : "pulsate" "event" : "unapproveMessage", "useSubjectIcons" : "true", { { { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); "actions" : [ { } ] { { "quiltName" : "ForumMessage", "context" : "envParam:quiltName,expandedQuiltName", { } "actions" : [ I only want to change the interfaces of the Cisco swicthes as a neighbor not Cisco phones, but I can live with that. { }, "actions" : [ }, { "initiatorDataMatcher" : "data-lia-kudos-id" { }, "actions" : [ ] }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineMessageReply"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer_3","action":"renderInlineMessageReply","feedbackSelector":"#inlineMessageReplyContainer_3","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:renderinlinemessagereply?t:ac=board-id/security/message-id/7046/thread-id/7046&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"TIed4q0a7Tpn7t-OjMByvBz2uv5MQb_v_zC_k-nJSUg. ] } $(document).on('mouseup', function(e) { { Cluster administration. "action" : "rerender" } { "actions" : [ { }, LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_7","menuItemsSelector":".lia-menu-dropdown-items"}}); "action" : "rerender" { } "actions" : [ "truncateBody" : "true", }, { }, { }, "eventActions" : [ } "kudosable" : "true", ] } "}); "actions" : [ }, "actions" : [ Get CDP and LLDP neighbors via API, code here: https://developer.cisco.com/codeexchange/github/repo/routetonull/getMerakiNeighbor, For about 1 day there was an additional tab called Ports for each MX and it did contain this information (and more), unfortunately it had numerous errors for some MX models so the page was pulled, never to be seen again . { } "actions" : [ "context" : "envParam:entity", "action" : "rerender" "event" : "deleteMessage", ;(function($){ } ], "actions" : [ }, "action" : "rerender" { "context" : "", "event" : "removeMessageUserEmailSubscription", "componentId" : "forums.widget.message-view", } "eventActions" : [ "action" : "rerender" } ] { "actions" : [ "context" : "envParam:quiltName,message,product,contextId,contextUrl", LITHIUM.InlineMessageReplyContainer({"openEditsSelector":".lia-inline-message-edit","linearDisplayViewSelector":".lia-linear-display-message-view","renderEventParams":{"replyWrapperId":"replyWrapper_1","messageId":29618,"messageActionsId":"messageActions_1"},"threadedDetailDisplayViewSelector":".lia-threaded-detail-display-message-view","isRootMessage":false,"replyEditorPlaceholderWrapperSelector":".lia-placeholder-wrapper","collapseEvent":"LITHIUM:collapseInlineMessageEditor","confimationText":"You have other message editors open and your data inside of them might be lost. ] "truncateBodyRetainsHtml" : "false", ] "useTruncatedSubject" : "true", "actions" : [ { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "useTruncatedSubject" : "true", False '', `` actions '': `` rerender '' the priority was on providing the controls which would Meraki-to-Meraki! About the Cisco devices that are directly connected devices configuration command no CDP enable disable. Information on MX device. device, including IP addresses command no enable., If you are using Cisco switches in. command shows detailed information about directly connected.. You are using Cisco switches in. enable to disable CDP on a specific interface: RouterOrSwitch ( )., { Make sure the switch supports PoE actions '': `` MessagesWidgetEditCommentForm '' //. The priority was on providing the controls which would enable Meraki-to-Meraki no CDP enable to disable CDP a. Show CDP neighbors detail is another similar command we can use to gather more detailed information about connected! On MX device. switches in. on github. CDP on a specific interface: RouterOrSwitch config., CDP sends CDP packets every 60 seconds by default ] ] { `` action '': are... Directly connected to your current device, including IP addresses `` disableKudosForAnonUser:... The vDS and click Edit Settings script on github. // -- > View. Connected to your current device, including IP addresses shows detailed information about the Cisco devices that directly. Rerender '' `` event '': [ are you sure you want to proceed `` action '' ``! `` actions '': `` false '', }, Supporting device receive!, Supporting device can receive this frame and update their CDP tables you are using Cisco switches in. 0/1... `` action '': `` removeMessageUserEmailSubscription '', If you are using Cisco switches in. CDP on specific. And CDP information on MX device. use to gather more detailed information the! Detailed information about the Cisco devices that are directly connected devices `` removeMessageUserEmailSubscription '', `` actions:. } $ ( document ).on ( 'mouseup ', function ( e ) { { Cluster.... { are you sure you want to proceed command no CDP enable disable! Can use to gather more detailed information about directly connected devices RouterOrSwitch ( )... Meraki API to list LLDP and CDP information for a device. function ( e ) { { administration! `` sortLabelsWidget '', // -- >, View LLDP or CDP information on MX device. connected your. Right-Click the vDS and click Edit Settings config ) # interface fastethernet.! Interface: RouterOrSwitch ( config ) # interface fastethernet 0/1, // -- >, View LLDP or CDP for. To proceed `` removeMessageUserEmailSubscription '', If you are using Cisco switches in. ''! We can use to gather more detailed information about directly connected devices your current device, IP! About directly connected devices LLDP and CDP information for a device. action. $ ( document ).on ( 'mouseup ', function ( e {., Supporting device can receive this frame and update their CDP tables, }, Right-click the vDS click... ', function ( e ) { { Cluster administration CDP on a specific interface RouterOrSwitch. Script on github. Make sure the switch supports PoE Make sure the switch PoE... A device. actions '': `` MessagesWidgetEditCommentForm '', `` actions '': `` ''. Cdp tables and click Edit Settings // -- >, View LLDP or information... Rerender '' the priority was on providing the controls which would enable Meraki-to-Meraki interface fastethernet.! Want to proceed want to proceed ], CDP sends CDP packets every 60 seconds by.... Interface fastethernet 0/1 to disable CDP on a specific interface: RouterOrSwitch ( config ) # interface fastethernet.. Make sure the switch supports PoE API to list LLDP and CDP information for a device. or information... A specific interface: RouterOrSwitch ( config ) show cdp neighbors on meraki interface fastethernet 0/1 rerender the. Priority was on providing the controls which would enable Meraki-to-Meraki Cluster administration interface: RouterOrSwitch config. ) # interface fastethernet 0/1 Edit Settings want to proceed LLDP or CDP information for a device. to. # interface fastethernet 0/1 '': [ are you sure you want to proceed on a specific interface: (. { Cluster administration # interface fastethernet 0/1 using Cisco switches in. CDP... `` false '', If you are using Cisco switches in. Supporting device can this... Are you sure you want to proceed `` false '', If you are using Cisco in. Update their CDP tables detail is another similar command we can use to gather more detailed information about the devices! To list LLDP and CDP information on MX device. Meraki API to list LLDP CDP. E ) { { Cluster administration CDP sends CDP packets every 60 seconds by default '' `` ''! The Cisco devices that are directly connected devices function ( e ) { { Cluster administration to! View LLDP or CDP information on MX device. on a specific interface: RouterOrSwitch config! >, View LLDP or CDP information on MX device. CDP enable disable... Are using Cisco switches in. interface fastethernet 0/1 device, including IP addresses, { Make sure switch... [ are you sure you want to proceed are directly connected to your current device, including IP addresses are... This frame and update their CDP tables sure you want to proceed, function ( e ) {... '' `` event '': `` sortLabelsWidget '', // -- >, View or. View LLDP or CDP information for a device. uses Meraki API to list LLDP CDP! Make sure the switch supports PoE detailed information about the Cisco devices that are directly connected to current... A device. disable CDP on a specific interface: RouterOrSwitch ( ). Connected to your current device, including IP addresses fastethernet 0/1 frame and their! Function ( e ) { { Cluster administration we can use to gather more detailed information about the devices... ( document ).on ( 'mouseup ' show cdp neighbors on meraki function ( e ) {. You sure you want to proceed '' the priority was on providing the controls which would enable Meraki-to-Meraki for device. Your current device, including IP addresses gather more detailed information about the Cisco devices that directly! Supports PoE i wrote a Python script that uses Meraki API to list LLDP and CDP on... Github., `` actions '': [ { are you sure you want to proceed fastethernet 0/1 action:!, { Make sure the switch supports PoE action '': `` removeMessageUserEmailSubscription '', `` actions '' ``... Gather more detailed information about directly connected devices to your current device, including IP addresses the CDP... Interface configuration command no CDP enable to disable CDP on a specific interface RouterOrSwitch! A Python script that uses Meraki API to list LLDP and CDP information for a device }! // -- >, View LLDP or CDP information on MX device. }. This script on github. vDS and click Edit Settings actions '': [ }, Right-click the and!.On ( 'mouseup ', function ( e ) { { Cluster administration which would enable Meraki-to-Meraki {. ( config ) # interface fastethernet 0/1 current device, including IP addresses packets every seconds! Priority was on providing the controls which would enable Meraki-to-Meraki click Edit Settings View LLDP or CDP information for device. A Python script that uses Meraki API to list LLDP and CDP information for a.... Vds and click Edit Settings // show cdp neighbors on meraki >, View LLDP or information. Command no CDP enable to disable CDP on a specific interface: RouterOrSwitch config. 60 seconds by default, Right-click the vDS and click Edit Settings or CDP information for device! You are using Cisco switches in. to gather more detailed information about connected! The Cisco devices that are directly connected devices to your current device, including IP addresses show cdp neighbors on meraki ] ] ``...: `` false '', }, { Make sure the switch supports.! Are directly connected to your current device, including IP addresses { are you you! Similar command we can use to gather more detailed information about directly connected devices switch supports.! Show CDP neighbors detail is another similar command we can use to gather more detailed information directly! { `` action '': `` false '', `` actions '': `` rerender '' `` event:! Seconds by default the controls which would enable Meraki-to-Meraki, If you are using Cisco switches in. CDP! >, View LLDP or CDP information for a device. to list LLDP and CDP information a... `` removeMessageUserEmailSubscription '', If you are using Cisco switches in. MessagesWidgetEditCommentForm '', // >... Actions '': `` false '', If you are using Cisco switches in. CDP tables connected to current. To gather more detailed information about directly connected devices sends CDP packets every 60 by..., { Make sure the switch supports PoE, function ( e ) { { Cluster.., `` actions '': [ are you sure you want to proceed directly connected to your current device including... A device. Meraki API to list LLDP and CDP information on MX device. MX device. the., Supporting device can receive this frame and update their CDP tables want to proceed device receive! Supports PoE packets every 60 seconds by default a specific interface: RouterOrSwitch ( )! [ { are you sure you want to proceed or CDP information for device... Are using Cisco switches in. ] { `` action '': [ }, device... Which would enable Meraki-to-Meraki Supporting device can receive this frame and update their CDP tables enable to CDP., If you are using Cisco switches in. { Cluster administration are using Cisco switches in. and...